PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01701.1.p
Common NameEUGRSUZ_D01701, LOC104441632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 301aa    MW: 34268.9 Da    PI: 9.8415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01701.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W+  Ed+ll++ ++ +G g+Wk+ +++ g+ R++k+c++rw +yl
  Eucgr.D01701.1.p 14 RGPWSVKEDKLLIQHIQAHGEGHWKSMPKRAGLLRCGKSCRLRWMNYL 61
                      89******************************99************97 PP

2Myb_DNA-binding50.93.7e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ T++E++l+v+++++lG++ W++Ia +++  Rt++++k++w+++l
  Eucgr.D01701.1.p  67 RGNITPDEEDLIVRLHALLGNR-WSLIAGRLP-SRTDNEIKNYWNSHL 112
                       7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.545961IPR017930Myb domain
SuperFamilySSF466891.03E-2811108IPR009057Homeodomain-like
SMARTSM007176.1E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-141461IPR001005SANT/Myb domain
CDDcd001676.38E-101661No hitNo description
PROSITE profilePS5129425.2562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001678.93E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWSVK EDKLLIQHIQ AHGEGHWKSM PKRAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPDEEDLIVR LHALLGNRWS LIAGRLPSRT DNEIKNYWNS HLSKRVNDNN  120
HQRNRNNRGV KGPKKRNIVT ANKVRSFTNK QKQEMTNEKG ETKLTKIKVH QPKPTRVSAV  180
ARNNICNSLP WGSCVNTSNN NILEEQLPQQ LPPYPSSGLT ARSSASDIEG VLVLDEDLIN  240
VSGECYYYDH HQETTSSREI LIPTREENDS MLQKIFEDFQ ELLGAKDSVQ METFVNSLLI  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01701.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053095.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A059CGF90.0A0A059CGF9_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s14420.12e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3441522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.15e-62myb domain protein 5